PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0063s0110.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family Whirly
Protein Properties Length: 268aa    MW: 30500.9 Da    PI: 9.4408
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0063s0110.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly116.91.4e-36121203183
               Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaak 83 
                          s+yk+kaal+v++++p+f+ +dsg+ k++++G++ l++a+a ++r+ydW++kq+f+ls+ ev+++++l++k+sceffhdp+++
  Kalax.0063s0110.1.p 121 SIYKGKAALTVEPRAPDFSLMDSGAYKISKDGFVYLQFAPASGVRQYDWSRKQVFSLSVFEVGSIISLGPKDSCEFFHDPFKG 203
                          7*******************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.101.1E-39113204IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544474.32E-56115264IPR009044ssDNA-binding transcriptional regulator
PfamPF085362.5E-34122204IPR013742Plant transcription factor
Gene3DG3DSA:2.30.31.106.4E-13206251IPR009044ssDNA-binding transcriptional regulator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MANLRVFAPQ FAFRNPRKPP QLHISSYESI ASVNFALPVR TRATSHSGRT KPYLECMQSE  60
YFEPQRFSSS RRSMERFRSD DDGGGEVVCF NFAGRFIGLG FVMMELWLWI ECRRKVYVGY  120
SIYKGKAALT VEPRAPDFSL MDSGAYKISK DGFVYLQFAP ASGVRQYDWS RKQVFSLSVF  180
EVGSIISLGP KDSCEFFHDP FKGRRLLNVD ESIYIPINKA EFTVLVSAMK FILPYLLGWN  240
AFANSIKPED SLRGNNANAS VDFEWSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_D2e-7211526637219p24: plant transcriptional regulator PBF-2
1l3a_C2e-7211526637219p24: plant transcriptional regulator PBF-2
1l3a_B2e-7211526637219p24: plant transcriptional regulator PBF-2
1l3a_A2e-7211526637219p24: plant transcriptional regulator PBF-2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002277278.12e-78PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic
SwissprotQ66GR66e-77WHY3_ARATH; Single-stranded DNA-binding protein WHY3, chloroplastic
TrEMBLD7TND72e-78D7TND7_VITVI; Putative uncharacterized protein
STRINGVIT_01s0026g01720.t015e-78(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02740.23e-76ssDNA-binding transcriptional regulator