PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0056s0122.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family ZF-HD
Protein Properties Length: 107aa    MW: 11462.8 Da    PI: 8.9349
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0056s0122.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer106.21.9e-333591360
          ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                          vrY eC+kNhAa++Gg+avDGC+Efm+s g egt++al+CaACgCHRnFHR+eve+e
  Kalax.0056s0122.1.p 35 IVRYGECQKNHAANVGGYAVDGCREFMAS-GMEGTSEALRCAACGCHRNFHRKEVETE 91
                         589*************************9.999*********************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257746.0E-2934100IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.3E-303688IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.6E-273788IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.7493887IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 107 aa     Download sequence    Send to blast
MKKQRQVGLR KDASKRSSSS SASGRGRMMT TTSSIVRYGE CQKNHAANVG GYAVDGCREF  60
MASGMEGTSE ALRCAACGCH RNFHRKEVET EVVCECSPPH SSNSNV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012080548.15e-44PREDICTED: mini zinc finger protein 3
SwissprotQ9CA512e-39MIF1_ARATH; Mini zinc finger protein 1
TrEMBLA0A067KG853e-43A0A067KG85_JATCU; Uncharacterized protein
STRINGVIT_14s0108g00810.t017e-39(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.15e-40mini zinc finger 1