PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0055s0091.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family Whirly
Protein Properties Length: 277aa    MW: 30250.6 Da    PI: 10.093
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0055s0091.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly193.14.2e-601022392139
               Whirly   2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvr 91 
                          v+k+kaal+v +v+ptf +ldsg l+l+r+G ++l++ +a++erkydWek+qsfalsatev++l+ l++++sceffhdp++k+sn+G+vr
  Kalax.0055s0091.4.p 102 VFKGKAALSVSPVLPTFRKLDSGGLQLDRRGVMMLNIWPAIGERKYDWEKRQSFALSATEVGSLLTLGPQDSCEFFHDPSMKTSNAGQVR 191
                          9***************************************************************************************** PP

               Whirly  92 kalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                          k+l+++  +d sG+f++lsv n+++k+ e+++vPv+ aefav+r++++
  Kalax.0055s0091.4.p 192 KSLSIKANADNSGYFFSLSVANNILKTSERLTVPVTSAEFAVMRTAFS 239
                          *********************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.103.7E-7389253IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544473.53E-6394258IPR009044ssDNA-binding transcriptional regulator
PfamPF085362.1E-59102236IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MAQRLKFVGA LRSKHLFAAS SPTFSIMSHQ FYGNSSEAHQ SRQFLNNEIK LRAPGVMGCS  60
SKSSFTGNSC LYSSLMTCRS LYAQAAASSD NPSSKVYAPF TVFKGKAALS VSPVLPTFRK  120
LDSGGLQLDR RGVMMLNIWP AIGERKYDWE KRQSFALSAT EVGSLLTLGP QDSCEFFHDP  180
SMKTSNAGQV RKSLSIKANA DNSGYFFSLS VANNILKTSE RLTVPVTSAE FAVMRTAFSF  240
ALPHIMGWDR IACQLSAGVS YSTKAAPLVK DMEWDR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3n1h_A1e-889525410169StWhy2
3n1i_A1e-889525410169protein StWhy2
3n1j_A1e-889525410169Protein StWhy2
3n1k_A1e-889525410169protein StWhy2
3n1l_A1e-889525410169protein StWhy2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016511180.19e-94PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X6
RefseqXP_019236143.19e-94PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X1
RefseqXP_019236148.18e-94PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X6
RefseqXP_019236149.17e-94PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X7
SwissprotD9J0348e-93WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLA0A1J6KGD62e-92A0A1J6KGD6_NICAT; Single-stranded dna-bindig protein why2, mitochondrial
TrEMBLA0A1S4DCL12e-92A0A1S4DCL1_TOBAC; single-stranded DNA-bindig protein WHY2, mitochondrial isoform X6
STRINGXP_009772771.14e-93(Nicotiana sylvestris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.18e-87WHIRLY 2