PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0055s0091.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family Whirly
Protein Properties Length: 198aa    MW: 21791 Da    PI: 10.3486
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0055s0091.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly194.41.6e-60231602139
               Whirly   2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvr 91 
                          v+k+kaal+v +v+ptf +ldsg l+l+r+G ++l++ +a++erkydWek+qsfalsatev++l+ l++++sceffhdp++k+sn+G+vr
  Kalax.0055s0091.2.p  23 VFKGKAALSVSPVLPTFRKLDSGGLQLDRRGVMMLNIWPAIGERKYDWEKRQSFALSATEVGSLLTLGPQDSCEFFHDPSMKTSNAGQVR 112
                          9***************************************************************************************** PP

               Whirly  92 kalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                          k+l+++  +d sG+f++lsv n+++k+ e+++vPv+ aefav+r++++
  Kalax.0055s0091.2.p 113 KSLSIKANADNSGYFFSLSVANNILKTSERLTVPVTSAEFAVMRTAFS 160
                          *********************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.101.7E-7311174IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.18E-6315179IPR009044ssDNA-binding transcriptional regulator
PfamPF085368.3E-6023157IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MATARKRINR DNPSSKVYAP FTVFKGKAAL SVSPVLPTFR KLDSGGLQLD RRGVMMLNIW  60
PAIGERKYDW EKRQSFALSA TEVGSLLTLG PQDSCEFFHD PSMKTSNAGQ VRKSLSIKAN  120
ADNSGYFFSL SVANNILKTS ERLTVPVTSA EFAVMRTAFS FALPHIMGWD RIACQLSAGV  180
SYSTKAAPLV KDMEWDR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3n1h_A2e-8911721166StWhy2
3n1i_A2e-8911721166protein StWhy2
3n1j_A2e-8911721166Protein StWhy2
3n1k_A2e-8911721166protein StWhy2
3n1l_A2e-8911721166protein StWhy2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009772779.16e-95PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X2
RefseqXP_009772788.16e-95PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X3
RefseqXP_016511177.16e-95PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X3
RefseqXP_016511178.16e-95PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X4
RefseqXP_019236145.16e-95PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X3
SwissprotD9J0343e-93WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLA0A1S4DCK91e-93A0A1S4DCK9_TOBAC; single-stranded DNA-bindig protein WHY2, mitochondrial isoform X3
TrEMBLA0A1S4DCW11e-93A0A1S4DCW1_TOBAC; single-stranded DNA-bindig protein WHY2, mitochondrial isoform X4
TrEMBLA0A1U7W2E71e-93A0A1U7W2E7_NICSY; single-stranded DNA-bindig protein WHY2, mitochondrial isoform X3
TrEMBLA0A1U7WDQ31e-93A0A1U7WDQ3_NICSY; single-stranded DNA-bindig protein WHY2, mitochondrial isoform X2
STRINGXP_009772771.17e-94(Nicotiana sylvestris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.12e-87WHIRLY 2