PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0047s0111.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family TCP
Protein Properties Length: 249aa    MW: 25669.9 Da    PI: 10.1454
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0047s0111.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP120.71.7e-3732115387
                  TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsss 87 
                           kk + +++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++a+++ ++s s  +++sss
  Kalax.0047s0111.1.p  32 LKKPPAKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTIPANFS-TVSASLRGAASSS 115
                          699*****************************************************************888.3333333332222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.9E-3437121IPR005333Transcription factor, TCP
PROSITE profilePS5136927.8923791IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MSTSADGGGG PPSNGGGGGL VAVVSDKSHL PLKKPPAKDR HSKVDGRGRR IRMPIICAAR  60
VFQLTRELGH KSDGQTIEWL LRQAEPSIIA ATGTGTIPAN FSTVSASLRG AASSSAPAPL  120
HHQLLAPTPF ILGKRLRADD DVESSDGAVK EAGPTTGGFW AVPARPDLGQ IWSFAGGAPE  180
LVMAAPSSQG MMMSAGRFVQ AMGEASVARV GNYLPMATTQ GHLDLLASLS ANGSSNSGRR  240
DEHHSDHR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00524DAPTransfer from AT5G23280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2407981e-60AK240798.1 Oryza sativa Japonica Group cDNA, clone: J065002G04, full insert sequence.
GenBankAP0047761e-60AP004776.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0452F04.
GenBankAP0149581e-60AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126101e-60CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019163704.12e-94PREDICTED: transcription factor TCP7-like
SwissprotQ9FMX22e-82TCP7_ARATH; Transcription factor TCP7
TrEMBLA0A2R6PGI93e-90A0A2R6PGI9_ACTCH; Transcription factor like
STRINGSolyc01g008230.2.14e-87(Solanum lycopersicum)
STRINGSolyc04g009180.1.16e-87(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.13e-73TCP family protein