PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0011s0018.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family ZF-HD
Protein Properties Length: 238aa    MW: 26229.1 Da    PI: 7.669
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0011s0018.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.55e-3147103360
          ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                           vrY+eClkNhA+ +Ggha+DGCgEf+++ g++gt ++++CaAC CHRnFHR+e++ e
  Kalax.0011s0018.1.p  47 VVRYRECLKNHAVGIGGHALDGCGEFIAA-GDDGTLESMTCAACSCHRNFHRKETDGE 103
                          69**************************9.999*********************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047707.5E-2948100IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.6E-284999IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.9795099IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-1753101IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466899.45E-18161236IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-29164236IPR009057Homeodomain-like
TIGRFAMsTIGR015652.6E-26175232IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MDQFGHNHDH GNEIEEEEIV PVHESLTNLR RLNVSGEGGS SGGRRRVVRY RECLKNHAVG  60
IGGHALDGCG EFIAAGDDGT LESMTCAACS CHRNFHRKET DGESAFHPNA QFSPYYHHRS  120
PPPGFLHMAL PPSVAEGRHR QPLALQSREE LDDMSNPSSS GGGGGGGSTP GGGNKKRFRT  180
KFTAEQKERM MELAERLGWR LQRQDDALVQ QFCLDNGVSR QVLKVWMHNN KNTFGKK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-261762331875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010266504.19e-75PREDICTED: zinc-finger homeodomain protein 1-like
SwissprotQ9SB613e-67ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLA0A067FAZ13e-72A0A067FAZ1_CITSI; Uncharacterized protein
TrEMBLV4SG213e-72V4SG21_9R
STRINGBra013822.1-P1e-70(Brassica rapa)
STRINGGLYMA02G04550.22e-70(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.19e-59homeobox protein 22