PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0002s0190.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family ZF-HD
Protein Properties Length: 300aa    MW: 32868.2 Da    PI: 8.6928
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0002s0190.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer86.92e-2790144358
          ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                          +v+Y+eClkNhAa + +++vDGCgEfmp  g+eg+ +alkCaAC+CHRnFH re e
  Kalax.0002s0190.1.p  90 GVHYRECLKNHAAIMETNVVDGCGEFMPG-GKEGSLEALKCAACQCHRNFHCRELE 144
                          699*************************9.999*******************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.0E-2491143IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-1691144IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.1E-2592142IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152323.25493142IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.7E-24204275IPR009057Homeodomain-like
SuperFamilySSF466893.46E-12209275IPR009057Homeodomain-like
TIGRFAMsTIGR015653.4E-25214271IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MILDHKILLG NLPPPPPLAY PPSSTIEQPP RTNTSLHNHD AEVEDKKNGV LLLSAPSAGG  60
GGGQLQSPES SKLSPVGTRS KPVKSASPSG VHYRECLKNH AAIMETNVVD GCGEFMPGGK  120
EGSLEALKCA ACQCHRNFHC RELESGSSNL FAWSVIGLHL YPPIQIPLHH HHHQIVQPVA  180
VAYGGGATES SSEDLVQALD KMPQREAEPG SVRNRFGTKF TQEQKDKMLG FAERLGWRLQ  240
RQDDDQVVER FCSEVGVRRQ ALKMWMHNNK NSFKKPSRRR SAAANTQPPS HTTHPQIQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-242152721975ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010102085.17e-62hypothetical protein L484_009028
RefseqXP_010539898.13e-62PREDICTED: zinc-finger homeodomain protein 5 isoform X1
RefseqXP_010539899.13e-62PREDICTED: zinc-finger homeodomain protein 5 isoform X2
RefseqXP_010539900.13e-62PREDICTED: zinc-finger homeodomain protein 5 isoform X1
TrEMBLW9S6C38e-62W9S6C3_9R
STRINGPOPTR_0007s12970.11e-57(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.13e-47homeobox protein 21