PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0515s0212.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family FAR1
Protein Properties Length: 800aa    MW: 92762.2 Da    PI: 8.8273
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0515s0212.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR180.13.9e-2596182290
                 FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                           Yn+YA + GF +rk+ s +s+rnge++++++vC+keg+++   ++  +++++r   rtgC+ak+++ ++ +gkw+v+k++ eHnH+l+
  Kaladp0515s0212.1.p  96 AYNHYAARRGFGIRKHFSARSRRNGEVIRKEYVCNKEGFKNVVPQT-IDHKKRRRDARTGCQAKIEIGQK-SGKWVVDKFSDEHNHPLT 182
                          5*****************************************9999.89999999*************99.****************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.7E-2396182IPR004330FAR1 DNA binding domain
PfamPF105514.5E-35304397IPR018289MULE transposase domain
PROSITE profilePS5096610.039581617IPR007527Zinc finger, SWIM-type
SMARTSM005751.4E-5592619IPR006564Zinc finger, PMZ-type
PfamPF044343.9E-4593610IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 800 aa     Download sequence    Send to blast
MDQPNNNPQP TETETRPEEG ADGALFYSGF PISQQSRLEN FMDYGSVLSN NLMEDAPIQM  60
DSRNTDNTIV RDASCEKVVD SLLGKYFDTM EEAYDAYNHY AARRGFGIRK HFSARSRRNG  120
EVIRKEYVCN KEGFKNVVPQ TIDHKKRRRD ARTGCQAKIE IGQKSGKWVV DKFSDEHNHP  180
LTSPNKVLKH RSHCKYHKSI EGKKLIYDLH AAGLTPSQIM KAVNTLTGTL HEDITAKKCS  240
EVLRTHKRNH VGKECLGIIK HFQEKSGRGD DFYFNVQIDN DGCLRNVFWA DERSRTSYLK  300
FGDVMVFDVT YRTNKFKMPF SPFVGVNHHR QSVLFGGALL DDETEETFVW LFEQFLKCMN  360
FKPPQAIITD QDKAIRNAVK RVFPDARHRF CAWHIKKHVL EHIQPFRTRY KDFADTFYIW  420
IKSKSPKEFE EGWKILNEKY KIGEKGWLPT MYKDRRYWVK CYLKNTFFAG MTTSGRSESI  480
HSFFDGYVNA TTPLNEFVVQ YDKAVAARRK SEEDEDFSTL NSQPALITEH GIEKDAGRYY  540
TRSIFQLFQR EWHASLSLEH TKRQISDMLV SYFVGSDREQ QTVEYDSEQQ IVRCSCAKFE  600
TDGILCKHAL YILKKKKIKN LPKNYLLYRW TIDARYHMAH KLVESEDAKA SDHVVSAEEK  660
WVARTMFHQI IRDADYSPSI FKEFIQTSKI FMVRLRGERE VTENALIVES SIQSQSTCEV  720
SHVELEPTQV TILDPACDKV NKGRPKSASR IPSAIEKIKN YKCSECKRNG HNKTTCPEKK  780
VGHVHHDDQI SQLDSVINL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1612622LKKKKIKNLPK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-124FAR1-related sequence 5