PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0430s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family FAR1
Protein Properties Length: 129aa    MW: 14799.8 Da    PI: 8.7376
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0430s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR163.75.3e-2046124484
                 FAR1   4 neYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtklele 84 
                          n+YA + GF +rk+   +s+rnge++++++vC+keg+++   ++  +++++r   rtgC+ak+++ ++ +gkw+v+k++ e
  Kaladp0430s0001.1.p  46 NHYAVRRGFGIRKHFLARSRRNGEVIRKEYVCNKEGFKNVVPQT-IDHKKRRRDARTGCQAKMEIGQK-SGKWVVDKFNDE 124
                          79**************************************9999.89999999*************99.9*******9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.6E-1846123IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MEDALIQMDS GNTDNTIVRD ASCEKVVDSL LGKYFDTMEE AYDANNHYAV RRGFGIRKHF  60
LARSRRNGEV IRKEYVCNKE GFKNVVPQTI DHKKRRRDAR TGCQAKMEIG QKSGKWVVDK  120
FNDEVFCC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18960.15e-16FAR1-related sequence 12