PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0399s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family FAR1
Protein Properties Length: 93aa    MW: 10877.3 Da    PI: 8.4525
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0399s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR136.81.2e-113782247
                 FAR1  2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk 47
                          Yn+Y  + GF +rk+ +++s+r++ei+++++vC+keg+++ e + 
  Kaladp0399s0002.1.p 37 AYNQYNARRGFCIRKHFTTRSRRTEEIIRKEYVCNKEGFKKVEPQM 82
                         5***************************************988766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.7E-103782IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MKFGNTDNDA IFDASCEKVV DSLSEKYYDI MEEAYDAYNQ YNARRGFCIR KHFTTRSRRT  60
EEIIRKEYVC NKEGFKKVEP QMRKKDLTAV AA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-