PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0095s0388.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 217aa    MW: 23428.7 Da    PI: 5.0128
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0095s0388.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.59.7e-43361351100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe +r da+ss+vyeA ar+rdPvyG++g i +lq+q+++l
  Kaladp0095s0388.1.p  36 PCAACKILRRRCADKCVLAPYFPPTEPHKFTIAHRVFGASNIIKFLQELPEAQRADAVSSMVYEASARIRDPVYGCAGAICQLQKQVSEL 125
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +a+la+ ++e
  Kaladp0095s0388.1.p 126 QAQLAKSQAE 135
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.21935136IPR004883Lateral organ boundaries, LOB
PfamPF031958.4E-4336133IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MEHRERTSTT PSPTSSLTSS PPSSPSQATT TVIMSPCAAC KILRRRCADK CVLAPYFPPT  60
EPHKFTIAHR VFGASNIIKF LQELPEAQRA DAVSSMVYEA SARIRDPVYG CAGAICQLQK  120
QVSELQAQLA KSQAEIVNMQ AQQAQLVALI CMEMSSVQPS KTTVKTAPDQ SFDCEGFIGS  180
PLVDDFYGGL GFEIESDGMG SLGWETPLWP DVMMTS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003597159.17e-87lateral organ boundaries (LOB) domain protein
SwissprotQ9SK082e-73LBD11_ARATH; LOB domain-containing protein 11
TrEMBLG7IKN38e-87G7IKN3_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA13G40370.21e-85(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.14e-74LOB domain-containing protein 11