PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0092s0234.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 373aa    MW: 42437.6 Da    PI: 5.0188
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0092s0234.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.72e-38431421100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          aCaaCk++rrkC+++C+l+pyfp++++++f n+hklFG+sn++k++++l++ ++++am+++++++++ra+dPv G++++i++lq  +e  
  Kaladp0092s0234.1.p  43 ACAACKYQRRKCEPNCILSPYFPHNRQAQFLNAHKLFGVSNITKIIRNLSPADKDQAMKTIIFQSDVRANDPVGGCYRIIRELQFMIEYY 132
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +ael+l+ ++
  Kaladp0092s0234.1.p 133 QAELDLVLHQ 142
                          ****998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.79342143IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-3543139IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MQLPRAPAFG NATGISPHLP KKMNPPTTTN TIPRIKNNTT TQACAACKYQ RRKCEPNCIL  60
SPYFPHNRQA QFLNAHKLFG VSNITKIIRN LSPADKDQAM KTIIFQSDVR ANDPVGGCYR  120
IIRELQFMIE YYQAELDLVL HQLSICRAQQ AQAQPQAHNK DNQQEQDDQQ QQQQQYLPFM  180
TSDQAANNNC SDPSSDVINA DPLNAYSPSS LQYSYHHQQQ QQLHLQLGGN NSNRGEEDNF  240
VLVQDNDHRY NNIQANADVW AVQHEEQQEQ MVNYCLNNNV EEDQNNSKDS FDQKKDLADN  300
MPCFERSTDK HKFNIEEDHA DGESSHEEAV LNGSKTLCRV EESDSVQNQG YEDEESADAW  360
FALTNCKRIK TA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002527399.12e-69PREDICTED: LOB domain-containing protein 22
TrEMBLB9SN302e-69B9SN30_RICCO; LOB domain-containing protein, putative
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-51LOB domain-containing protein 22