PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0081s0159.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family SRS
Protein Properties Length: 183aa    MW: 19084.9 Da    PI: 8.218
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0081s0159.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702100.14.1e-3196152561
               DUF702   5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaass 61 
                          +++CqdCGnqakkdC h+RCRtCCksrg++C+th+kstWvpa++rrerq  +++   
  Kaladp0081s0159.1.p  96 GSACQDCGNQAKKDCCHRRCRTCCKSRGYECSTHIKSTWVPASRRRERQLLTSSVXX 152
                          679*********************************************987766544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.1E-2797151IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.3E-2699140IPR006510Zinc finger, lateral root primordium type 1
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MGMGGLRDLF VVSPTSSFHH SSLNEPSLMA EGLGSGNPAT ALGVGLGVIP LLTAAPCVAD  60
GAGANGRSGG GGIQLWQSQA QNGVNNNNAS VLQTIGSACQ DCGNQAKKDC CHRRCRTCCK  120
SRGYECSTHI KSTWVPASRR RERQLLTSSV XXXXXXCELQ RDVTRADTGA GHVQVCEGDI  180
NK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ8477571e-62GQ847757.1 Kalanchoe blossfeldiana cultivar Celine SHI-related protein SRS1 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010651514.26e-46PREDICTED: protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA0A438KG415e-45A0A438KG41_VITVI; protein lateral ROOT PRIMORDIUM 1
TrEMBLF6HA244e-45F6HA24_VITVI; Uncharacterized protein
STRINGVIT_06s0009g03450.t016e-46(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.32e-30Lateral root primordium (LRP) protein-related