PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0071s0233.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 215aa    MW: 23325.4 Da    PI: 6.8613
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0071s0233.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.13e-43351341100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe +r da+ss+vyeA ar+rdPvyG++g+i++lq+ql++l
  Kaladp0071s0233.1.p  35 PCAACKILRRRCAEKCVLAPYFPPSEPHKFTIAHRVFGASNIIKFLQDLPEPQRADAISSMVYEAGARIRDPVYGCAGTIFQLQKQLNEL 124
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +aela++++e
  Kaladp0071s0233.1.p 125 QAELAKAQAE 134
                          ******9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.30434135IPR004883Lateral organ boundaries, LOB
PfamPF031958.0E-4335132IPR004883Lateral organ boundaries, LOB
CDDcd008907.72E-5116179No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MACHGDQAAV TGPRSVSHGE DSRAKCPRSG AVIGPCAACK ILRRRCAEKC VLAPYFPPSE  60
PHKFTIAHRV FGASNIIKFL QDLPEPQRAD AISSMVYEAG ARIRDPVYGC AGTIFQLQKQ  120
LNELQAELAK AQAEMVTMQC QQAQLVQTLF AMSNAPSSPE SSPDQQSSFC KGLIIGPSRS  180
PDSFRSNSSS LLEDDRPNGN PNSMWDMEET MCWS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007150227.12e-73hypothetical protein PHAVU_005G137300g
SwissprotQ9LQR04e-68LBD1_ARATH; LOB domain-containing protein 1
SwissprotQ9SK085e-68LBD11_ARATH; LOB domain-containing protein 11
TrEMBLV7C0152e-73V7C015_PHAVU; Uncharacterized protein
STRINGSolyc06g005090.2.14e-70(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.18e-57LOB domain-containing protein 1