PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0068s0350.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 104aa    MW: 11486.9 Da    PI: 4.0194
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0068s0350.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26040.48.2e-1314161101
               DUF260  61 lvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                          +vyeA+ar+rdPvyG++g i +lq+q+++l+ ela++++e+
  Kaladp0068s0350.1.p   1 MVYEANARLRDPVYGCAGAICHLQRQVSELQGELAKAQAEI 41 
                          69**********************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031957.4E-11138IPR004883Lateral organ boundaries, LOB
PROSITE profilePS508919.457141IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MVYEANARLR DPVYGCAGAI CHLQRQVSEL QGELAKAQAE IVAIQLQKSN LLTLICMDDQ  60
DQHMFSYGQC VDDTNQNVSF DELYGIGSFM DSSYANSLES LWA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003597159.12e-29lateral organ boundaries (LOB) domain protein
SwissprotQ9LQR07e-26LBD1_ARATH; LOB domain-containing protein 1
TrEMBLG7IKN32e-29G7IKN3_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA15G05030.14e-27(Glycine max)
STRINGGLYMA20G31780.15e-27(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-27LOB domain-containing protein 1