PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0060s0149.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 350aa    MW: 38380.8 Da    PI: 5.757
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0060s0149.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.86.7e-4261051100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk++rrkC+++C++apyfp e+p+kf nvhk+FG snv+k+l++l++ +reda++sl++eAear+rdP+yG+vg+i+ lqq+l+q 
  Kaladp0060s0149.1.p   6 PCAACKFQRRKCTPECIFAPYFPPEDPQKFVNVHKVFGGSNVSKILSDLNPAQREDAAKSLAFEAEARLRDPIYGCVGFISYLQQRLKQI 95 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +++l  +++e
  Kaladp0060s0149.1.p  96 QVDLTNARKE 105
                          ****999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.1065106IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-416103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MSSNSPCAAC KFQRRKCTPE CIFAPYFPPE DPQKFVNVHK VFGGSNVSKI LSDLNPAQRE  60
DAAKSLAFEA EARLRDPIYG CVGFISYLQQ RLKQIQVDLT NARKELSSYI GPSAMLPTLP  120
QHAYGQMVYH PQQQQMMGNQ LSSSSTFPYT NLMGTPAVYG PGTSQQLVIR EQQQQQIIGG  180
GNPTSSAAAL PYTSLMPSMI GDGGSSQPLL IREPQQLHGV DPQQYGAVDA AEQHEMIRNY  240
EQQQQDYFLL RSSDQYEPGG GQILGSGFIQ MAADETGGGP SLALGVNYDN PYSQVQQQQQ  300
QEVVHQSLQA QLVLQSRQQH AEHVLQTPLH QHPQNNADSN EGRSADPSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGVIT_07s0197g00020.t013e-71(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-58ASYMMETRIC LEAVES 2-like 1