PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0058s0115.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 215aa    MW: 23439.9 Da    PI: 8.8524
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0058s0115.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260119.61.7e-3723120198
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          aCaaCk++rrkCa++C+lapyfp+e++++f  +hklFG+sn+lk lk++p+  r++am s++++Aear  dPv G+++v+ +l +q+e  
  Kaladp0058s0115.1.p  23 ACAACKYQRRKCAPGCPLAPYFPSERASEFMSAHKLFGVSNILKALKKVPPGARDAAMISIMFHAEARRADPVGGCYAVVESLVKQIEVY 112
                          7***************************************************************************************** PP

               DUF260  91 kaelallk 98 
                          +ael+++ 
  Kaladp0058s0115.1.p 113 QAELDHVM 120
                          ***99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.95222123IPR004883Lateral organ boundaries, LOB
PfamPF031958.0E-3623119IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MNSNLKIPDN YSRSSALTSQ SQACAACKYQ RRKCAPGCPL APYFPSERAS EFMSAHKLFG  60
VSNILKALKK VPPGARDAAM ISIMFHAEAR RADPVGGCYA VVESLVKQIE VYQAELDHVM  120
REVYAFRALA AAQAEPRLVP GHVPRADVSV NNVGCQIKLE KQSSSMADEK QFYRTVETTP  180
FDGKGAEACL VRLGENWKPA FAAHDVGLKI FTNT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012453880.14e-42PREDICTED: LOB domain-containing protein 22-like
SwissprotQ9LRW11e-39LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A0D2VJ034e-42A0A0D2VJ03_G
STRINGBra021513.1-P5e-39(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.19e-41LOB domain-containing protein 22