PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0048s0907.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 301aa    MW: 33580.4 Da    PI: 4.9665
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0048s0907.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.84.3e-39101101101
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          aCaaCk++rr+C ++C lapyfpa+qpk f+n+h+lFG+sn+lk+lk+l+++++++am+s++y++++r + Pv G++g i++l+ q+++ 
  Kaladp0048s0907.1.p  10 ACAACKYQRRRCLPECQLAPYFPADQPKMFQNAHRLFGVSNILKILKQLDPSQKSEAMRSIIYQSDIRDKYPVAGCFGYIHQLHYQIQRG 99 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkeel 101
                          ++el+++++++
  Kaladp0048s0907.1.p 100 EEELHAIRSQI 110
                          *****999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.3699110IPR004883Lateral organ boundaries, LOB
PfamPF031954.7E-3710107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MTLKGGTSQA CAACKYQRRR CLPECQLAPY FPADQPKMFQ NAHRLFGVSN ILKILKQLDP  60
SQKSEAMRSI IYQSDIRDKY PVAGCFGYIH QLHYQIQRGE EELHAIRSQI ALCKMQQQQQ  120
TMGQNDDDNQ IMQTMQTTGI IGEDEDSTSL LQLGMGPPNN THNNNISSAN NNINNNNTMM  180
FENGGGYVNE QFCWNNNNNL MDFQLAGDVV QQQFAVVVPS SSQEMGAGIN NSSSLVHHFR  240
EMHPFLDAID DRQSFIDSKV AYESSSSEES SDPMKAMDHQ VVESTDLKNA AACFSLTSVN  300
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A068UF743e-81A0A068UF74_COFCA; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-49LOB domain-containing protein 27