PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0046s0097.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family FAR1
Protein Properties Length: 190aa    MW: 21736.7 Da    PI: 10.2433
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0046s0097.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR191.21.4e-2825112291
                 FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                          fYn+YA +vGF +r+sk ++s+r+g+ + r +vC+keg+r+ ++++  k  r+raetr+gC+a++ v+k ++gkw+vtk+++eH+H+l+p
  Kaladp0046s0097.2.p  25 FYNAYAARVGFVIRVSKLSRSRRDGSAIGRALVCNKEGYRSADRRE--KVVRQRAETRVGCRAMILVRKINSGKWVVTKFVSEHTHALTP 112
                          ******************************************9988..999************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031018.6E-2625112IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MASSVNGEEP YVGQEFDSES AAHAFYNAYA ARVGFVIRVS KLSRSRRDGS AIGRALVCNK  60
EGYRSADRRE KVVRQRAETR VGCRAMILVR KINSGKWVVT KFVSEHTHAL TPGKCRRDLI  120
YDQFPNEHDK IRELTQQLAT EKKRAASYKR HLEMIFQHIE EHNEGLAKKV QHIVDSVKDL  180
ESKEQRKHT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002267960.11e-115PREDICTED: protein FAR1-RELATED SEQUENCE 7
SwissprotQ9SZL82e-25FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLD7U1S11e-115D7U1S1_VITVI; Putative uncharacterized protein
STRINGVIT_05s0102g00690.t011e-114(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.23e-94FAR1 family protein