PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0045s0237.11.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family FAR1
Protein Properties Length: 759aa    MW: 87034.5 Da    PI: 7.2428
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0045s0237.11.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR182.95.3e-2629114291
                  FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                           +Y+eYAk vGF + k +s++s+ ++e+++++f C ++g++++++++     ++r++ ++gCka+++vk++++gkw++++++++HnHel 
  Kaladp0045s0237.11.p  29 YYKEYAKLVGFGTAKLSSRRSRASKEFIDAKFSCIRYGNKQQSDDA----INPRPSPKIGCKASMHVKRRQTGKWYIYNFVKDHNHELL 113
                           9***************************************999877....9************************************97 PP

                  FAR1  91 p 91 
                           p
  Kaladp0045s0237.11.p 114 P 114
                           5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031018.2E-2429114IPR004330FAR1 DNA binding domain
PfamPF105515.8E-25227319IPR018289MULE transposase domain
PROSITE profilePS5096610.237507543IPR007527Zinc finger, SWIM-type
PfamPF044341.1E-6517541IPR007527Zinc finger, SWIM-type
SMARTSM005751.1E-5518545IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 759 aa     Download sequence    Send to blast
MESSEATGNV TSEPHRELEF ESHEDAYSYY KEYAKLVGFG TAKLSSRRSR ASKEFIDAKF  60
SCIRYGNKQQ SDDAINPRPS PKIGCKASMH VKRRQTGKWY IYNFVKDHNH ELLPEQAHFF  120
RSHRNVDSIK NDLRIRKRKI LAAGSKQFSA YQNVDFLEGY IRNQHDKGQI LSLESGDSQM  180
LLEFCMYMQD KNPKFFYAMD FNEEHRLRNV FWVSSKGVDD YNYFSDVVSV DTTYVTAKYK  240
IPLVIIMGVN NHIQPTLLGC GLIADETLYT FVWLLQTWLI SMGGRAPRVI LTDQNSALKQ  300
AVAAVLPESR HCFALWNVLE KIPSKLEYVI RWQDNFVIKF DKCIYKSLTE EQFESRWSKL  360
LDRFTLREDE WVQSLYEDRR QWVPTFMRDI SFAGLSAPSR AESLNTWFDN YIDAYSSLRE  420
FIERYKLIVE DMHEEEAKAN FDGWHETPDL KTPSPFEKQT LLVYTHEIFK KFQIEVLGAA  480
ACHLKKENDY GTIATYSVKD FADNQVFMVT WDQTKLDIGC SCRSFEYKGY VCRHAIVVLQ  540
MSGVFSIPFK YILQRWTNVA VSRHAMSDRL DEVQAKIRRF NDLCRRAIIL GEEGSLSEQS  600
YNVALIAIED ALKQFKNTSS LDCDSRPHSA LRQAFSGNEE VNDGSVAAAV HEVPGTSLTS  660
SSKSQKRSDA GNKKFESYES MMGKVQPVQG LVNAGSQVGY AFMDNAHATS LIPNAPLVAQ  720
HNMAPVRLQS LPAHIQNTMP AQYHSSIPPY VEDKHIQG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002274627.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 4 isoform X1
SwissprotQ6NQJ70.0FRS4_ARATH; Protein FAR1-RELATED SEQUENCE 4
TrEMBLF6GYH10.0F6GYH1_VITVI; Putative uncharacterized protein
STRINGVIT_09s0054g01830.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76320.20.0FAR1-related sequence 4