PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0043s0229.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 183aa    MW: 20061.6 Da    PI: 6.8591
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0043s0229.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.82e-3910108199
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk lrrkC++dC+l+pyfp+++p++fa vhk+FGa+n++k+l+++p + r +a++++++eA  r+rdP+yG+vg+i++lqqq+ q+
  Kaladp0043s0229.1.p  10 RCAACKCLRRKCPADCILSPYFPSSNPQRFASVHKVFGAANITKMLEQVPMHLRGQAAECMIFEAATRTRDPIYGSVGIISQLQQQITQV 99 
                          6***************************************************************************************** PP

               DUF260  91 kaelallke 99 
                          ++e+ +++ 
  Kaladp0043s0229.1.p 100 QNEIMKIRG 108
                          ***998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.1989110IPR004883Lateral organ boundaries, LOB
PfamPF031958.7E-3910106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MSHYHSSSTR CAACKCLRRK CPADCILSPY FPSSNPQRFA SVHKVFGAAN ITKMLEQVPM  60
HLRGQAAECM IFEAATRTRD PIYGSVGIIS QLQQQITQVQ NEIMKIRGEI ALQSAQQQHN  120
QTQTTLRMEQ LSDQSGLDVG PDIGLGLDVD TGPSSGADAG SSSGRHYEMD LDEFYAKFNH  180
QP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011046521.16e-53PREDICTED: LOB domain-containing protein 24-like
SwissprotP594682e-42LBD24_ARATH; LOB domain-containing protein 24
TrEMBLB9HV381e-52B9HV38_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0010s25720.13e-47(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.11e-26LOB domain-containing protein 4