PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0040s0544.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family SRS
Protein Properties Length: 330aa    MW: 35629.7 Da    PI: 8.074
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0040s0544.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702195.41.9e-601232772154
               DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstkl 91 
                          r g++sCqdCGnqakk+C+h+RCRtCC srgfdC+thvkstWvpaakrrerqqq++ + ++ +a+a++++s    +  s ++ a s ++l
  Kaladp0040s0544.1.p 123 RRGSISCQDCGNQAKKECVHMRCRTCCMSRGFDCQTHVKSTWVPAAKRRERQQQMKRLRQDPKAAASASNSSLACT--SLTRLAPSPSTL 210
                          57899**************************************************999888766554444443333..345555555555 PP

               DUF702  92 ssaeskkeletsslPeevsseavfrcvrvssvdd.g....eeelaYqtavsigGhvfkGiLydqGlee 154
                           ++  +  +   +lP+ev+s avf+cvrvs +++ g    e++laYqt+v+igGh+f+GiLydqG+++
  Kaladp0040s0544.1.p 211 GEG-GRWATVGDELPREVRSCAVFKCVRVSPIEQqGeeglEQQLAYQTSVNIGGHLFRGILYDQGPQN 277
                          565.456778888*******************984322334679*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.4E-56126276IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.2E-27128170IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.0E-21223275IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MSGFFSLGGA NPQQPHHLNS SPETLIPPGN WFELRNEKLA ATYRRRGAIE LWHQQACHER  60
SSRSYDISNN PTSTSHLLGF GVGPTSVGAI DTSTQSDDQS VALGMITMSG SSCGVGLGSG  120
DGRRGSISCQ DCGNQAKKEC VHMRCRTCCM SRGFDCQTHV KSTWVPAAKR RERQQQMKRL  180
RQDPKAAASA SNSSLACTSL TRLAPSPSTL GEGGRWATVG DELPREVRSC AVFKCVRVSP  240
IEQQGEEGLE QQLAYQTSVN IGGHLFRGIL YDQGPQNHHY HHHSDCINLV SNTQQHASFG  300
ADPTAATNLY QAPNATFPGA SVVCTHFCP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19790.22e-47SHI-related sequence 7