PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0040s0399.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 164aa    MW: 17350.5 Da    PI: 7.9694
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0040s0399.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.91.7e-4318116199
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC ++C++apyfp e+p kfanvhk+FGasnv+kll+++++++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l
  Kaladp0040s0399.3.p  18 PCAACKFLRRKCLPGCTFAPYFPPEEPTKFANVHKIFGASNVSKLLNEISPHQREDAVNSLAYEAEARIKDPVYGCVGSISVLQRQVLKL 107
                          7***************************************************************************************** PP

               DUF260  91 kaelallke 99 
                          ++el+++++
  Kaladp0040s0399.3.p 108 QKELEATNA 116
                          ****99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.08717118IPR004883Lateral organ boundaries, LOB
PfamPF031955.2E-4318115IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MASSSSSSPS PCYYSNSPCA ACKFLRRKCL PGCTFAPYFP PEEPTKFANV HKIFGASNVS  60
KLLNEISPHQ REDAVNSLAY EAEARIKDPV YGCVGSISVL QRQVLKLQKE LEATNADLMR  120
YACDGSLAGV LGTGSGSRVS DGSSSASFDQ GSGCFVRFSS SNP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002521459.16e-73PREDICTED: LOB domain-containing protein 25
RefseqXP_009597524.11e-72PREDICTED: LOB domain-containing protein 25-like
RefseqXP_016505823.11e-72PREDICTED: LOB domain-containing protein 25-like
SwissprotQ8L8Q37e-71LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A068U1819e-74A0A068U181_COFCA; Uncharacterized protein
STRINGPOPTR_0001s35280.13e-72(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.11e-65LOB domain-containing protein 25