PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0039s0587.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 129aa    MW: 13662.8 Da    PI: 10.3008
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0039s0587.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26065.71.1e-2067114148
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllka 48 
                          +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++h++FGasn++k+l+ 
  Kaladp0039s0587.1.p  67 PCAACKILRRRCADKCVLAPYFPPTDPLKFTIAHRVFGASNIIKFLQV 114
                          7********************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.1966128IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-1967113IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MESIISNGKT TPPALTITPT TFNSFSSSFS SSPSSSSSPP SSHSSPTTAL PPASPLPPQP  60
QVIVMSPCAA CKILRRRCAD KCVLAPYFPP TDPLKFTIAH RVFGASNIIK FLQVPLKSTS  120
HFLSFWAL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013726732.19e-34PREDICTED: LOB domain-containing protein 11-like
STRINGGLYMA13G40370.21e-29(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.16e-32LOB domain-containing protein 11