PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0039s0078.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 211aa    MW: 23706.8 Da    PI: 9.0527
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0039s0078.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260109.82e-3410104195
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          aCaaCk++r++C ++C+lapyfp++++++f++vhk+FG sn++k++++l+ee++++a++sl++eA +r++dPv G +g +++l  +l+  
  Kaladp0039s0078.1.p  10 ACAACKHQRKRCDEKCILAPYFPSDRTREFQAVHKVFGLSNLQKMVRSLSEEDKRRATDSLIWEAFCRQKDPVLGPYGEYRRLFDELKLY 99 
                          7***************************************************************************************99 PP

               DUF260  91 kaela 95 
                          k++l+
  Kaladp0039s0078.1.p 100 KSQLQ 104
                          99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.5279110IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-3310104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MERGSATRTA CAACKHQRKR CDEKCILAPY FPSDRTREFQ AVHKVFGLSN LQKMVRSLSE  60
EDKRRATDSL IWEAFCRQKD PVLGPYGEYR RLFDELKLYK SQLQLPIQVS NFGTNNINGA  120
VTDHQFGTPN NNVALLNYVQ KNAGFASNQF TCSPHHKSPK GQGEIGSIIL PLQQRHLVNG  180
YNQQYCVKGQ FSPMNGEATT MESITWEGGS *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010688578.11e-61PREDICTED: LOB domain-containing protein 2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.11e-47LOB domain-containing protein 2