PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0036s0294.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 262aa    MW: 27445.8 Da    PI: 8.1686
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0036s0294.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601301e-40191181100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca++C+++pyf  ++p+kf +vhk+FGasnv+kll ++pe +r da++slvyeA++r+rdPvyG++g i +lqqql++l
  Kaladp0036s0294.1.p  19 PCAACKLLRRRCAEECPFSPYFSPHEPHKFLAVHKVFGASNVSKLLLEVPEGQRADAANSLVYEANVRLRDPVYGCMGAIAALQQQLHSL 108
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +a+l+++++e
  Kaladp0036s0294.1.p 109 QAQLDAVRSE 118
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.49218119IPR004883Lateral organ boundaries, LOB
PfamPF031958.7E-4119116IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MEKRVHLLGP AVALNKVTPC AACKLLRRRC AEECPFSPYF SPHEPHKFLA VHKVFGASNV  60
SKLLLEVPEG QRADAANSLV YEANVRLRDP VYGCMGAIAA LQQQLHSLQA QLDAVRSEIL  120
KHDIIRSQAA AAAAPSSSAP TVTITTNNSS TITVAAAGAD SSNNNISIST HHHHHLIRSP  180
SSGGTLSAVA MLPPSEQPQR PLTPPLHPAA SAQSAPSNSS SSSSTSGTAV TISSLYSTQQ  240
PNTSSSIGFS TNNNDGYMCF D*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGGLYMA14G38280.29e-70(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-56LOB domain-containing protein 15