PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0035s0029.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family FAR1
Protein Properties Length: 812aa    MW: 93164.9 Da    PI: 8.0631
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0035s0029.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1881.4e-2758145191
                 FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                          +fY+eYAk++GF++++++s++sk+++e+++++f Cs++g + e + +   ++r+ + ++t+Cka+++vkk+  gkw+v+++++eHnHel 
  Kaladp0035s0029.1.p  58 SFYQEYAKSMGFTTSIKNSRRSKKSKEFIDAKFACSRYGISPEPDCT---SSRRPTLKKTNCKASMHVKKRPGGKWVVYSFVKEHNHELL 144
                          5*****************************************99998...7788899*******************************97 PP

                 FAR1  91 p 91 
                          p
  Kaladp0035s0029.1.p 145 P 145
                          5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.7E-2558145IPR004330FAR1 DNA binding domain
PfamPF105515.3E-22265356IPR018289MULE transposase domain
PROSITE profilePS5096610.324546581IPR007527Zinc finger, SWIM-type
PfamPF044348.9E-7553578IPR007527Zinc finger, SWIM-type
SMARTSM005751.3E-6556583IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 812 aa     Download sequence    Send to blast
MVDHVQENHT YDGLNTNDAA TLLHKYGGAV DILEGDALQI EGEPHGGIEF ECHEAAYSFY  60
QEYAKSMGFT TSIKNSRRSK KSKEFIDAKF ACSRYGISPE PDCTSSRRPT LKKTNCKASM  120
HVKKRPGGKW VVYSFVKEHN HELLPALAYH FRIHKNVKVA EKNNIDILHA VSERTRKMYV  180
EMSRHSSEFW SFEFLKTDTV SQFDRGLHLA LDVGDAQFIL EYFKHVKKDS PGFLYAIDLN  240
EEHRLRNLFW VDAKSRSDYS SFSDVISLES CYIKNNNKMP FVPFVGVNNH FQPILLGCAL  300
VADDSKSTFV WLMKTWLRAM GGLAPKVIIT DHDQAMKMAV EEVFSTSCHC FSLHSILEKA  360
SEILIHVIQC HPKFLQKFNK CIFKSWTEED FDMRWWKMIG RFELQEYEWI RLLYDHRKKW  420
VPTYMKGTFL GGMCPIQRSE SMSAFLDRYI HKKITLKEFV RQYGTILHNI FEDEALADFD  480
TWHKQPALKS PSPWEKQVSA LYTHAIFKKF QVEVLGVVGC HIEKVGDDGT TVTFKVQDCE  540
KNERFYVAWI EAKSEVYCSC RSFEYRGFLC RHAMIVLQIC GFSSIPSQYI LTRWTKDAKS  600
MQSSSIGAIR VEDRIQRYNY LCKRAIELCE EGSLSQDNYS VAIRFLVEAL KNCVNENDSN  660
KNVGDSNNAS ILKEHHGSLA FKRNKKRNPN KKRRALSETE FSADTSSNLH QMEHLGTDVM  720
TLSGLYGTQQ NVPLNLMEPP HDAYYINQQS LQGLAQLTNI ASGHDIFFGP QQSTRSINNL  780
DFRVQANFTY GLQENTGSSP SHVHGSSSGR A*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00434DAPTransfer from AT4G15090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003631734.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
RefseqXP_010648202.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
SwissprotQ9SWG30.0FAR1_ARATH; Protein FAR-RED IMPAIRED RESPONSE 1
TrEMBLF6HTN00.0F6HTN0_VITVI; Putative uncharacterized protein
STRINGVIT_03s0017g01810.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15090.10.0FAR1 family protein