PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0028s0048.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 347aa    MW: 37947.3 Da    PI: 5.6943
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0028s0048.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.61.8e-4261051100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk++rrkC+++C++apyfp e+p+kf nvhk+FG snv+k+l++l++ +r+da++sl+yeAear+rdP+yG+vg+i+ lqq+l+q 
  Kaladp0028s0048.2.p   6 PCAACKFQRRKCTPECIFAPYFPPEDPQKFVNVHKVFGGSNVSKILSDLNPAQRDDAARSLAYEAEARLRDPIYGCVGLISYLQQRLKQI 95 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          + ++ ++++e
  Kaladp0028s0048.2.p  96 QIDITEARKE 105
                          ***9999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0695106IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-416103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MSSNAPCAAC KFQRRKCTPE CIFAPYFPPE DPQKFVNVHK VFGGSNVSKI LSDLNPAQRD  60
DAARSLAYEA EARLRDPIYG CVGLISYLQQ RLKQIQIDIT EARKELATYV GPSAMLMTIP  120
QHGYGQMMYH PQQPQMMGNP SSSSSALPYT HLMGTPPVYG PGTSQQLVIR DQQQQQLMGG  180
GNPSSSASAL PYTSLIPSMM GAGSSSQPLL TREQSQLHGV DPQQYGAVAA TEQHELMRNY  240
ELQQQQQQDY LQYEPGGGPI HGSGFIQMAA DETGGGPSLA LGVNYDNPYN QIQQQHQHDI  300
VHQALQAQLA LQSQLQHAEH VLQTPLDQQP QNKAESDEDR SADPSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002263109.22e-70PREDICTED: LOB domain-containing protein 36-like
STRINGVIT_07s0197g00020.t017e-70(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-57ASYMMETRIC LEAVES 2-like 1