PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0026s0146.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 157aa    MW: 17378 Da    PI: 7.8276
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0026s0146.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260112.62.7e-35190291
               DUF260  2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91
                         CaaCk lrrkC++dC+lapyfp+ +p++fa vh +FGa+n+ k+l+++p + r +a++++++eA +r+ dPvyG++g+i+klqqq++q++
  Kaladp0026s0146.1.p  1 CAACKCLRRKCPADCILAPYFPSWNPQRFAPVHNVFGAANMAKMLEQVPAHLRGQAADCMIFEAAMRMIDPVYGSAGIISKLQQQIKQMQ 90
                         ***************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.3651100IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-35190IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
CAACKCLRRK CPADCILAPY FPSWNPQRFA PVHNVFGAAN MAKMLEQVPA HLRGQAADCM  60
IFEAAMRMID PVYGSAGIIS KLQQQIKQMQ IMKIQGEVAL HQAQTILHLQ QLGDKSNTDP  120
GASRRADADS NNGQHYELDL DEFYVNFISS LNPKPF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011046521.12e-41PREDICTED: LOB domain-containing protein 24-like
SwissprotP594675e-35LBD23_ARATH; LOB domain-containing protein 23
TrEMBLB9HV382e-40B9HV38_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0012s13910.15e-38(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-32LOB domain-containing protein 24