PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0024s0815.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 214aa    MW: 23090.6 Da    PI: 7.3573
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0024s0815.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.94.9e-45111101100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++r+da++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql
  Kaladp0024s0815.1.p  11 PCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELHTSQRDDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLRQL 100
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          + +la +k+e
  Kaladp0024s0815.1.p 101 QLDLACAKSE 110
                          *****99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.61510111IPR004883Lateral organ boundaries, LOB
PfamPF031955.1E-4411108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MASASALTTS PCAACKFLRR KCQPECVFAP YFPPDQPQKF ANVHKVFGAS NVTKLLNELH  60
TSQRDDAVNS LAYEADMRLR DPVYGCVGVI SLLQHQLRQL QLDLACAKSE LSKYKTAISG  120
AAAAQRSGVI QGGGAHGGHG QHHHYLGGHG QYHHQYQVVR SESSFDSGND NSNEDEFDAG  180
GFLDMLSQFQ QSAGRGGPGG EHDRRTTAAV DRF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266137.14e-72PREDICTED: LOB domain-containing protein 6
RefseqXP_010646844.14e-72PREDICTED: LOB domain-containing protein 6
RefseqXP_010646845.14e-72PREDICTED: LOB domain-containing protein 6
RefseqXP_010646846.14e-72PREDICTED: LOB domain-containing protein 6
SwissprotO044791e-67LBD6_ARATH; LOB domain-containing protein 6
TrEMBLD7SSJ34e-72D7SSJ3_VITVI; Putative uncharacterized protein
STRINGVIT_00s0340g00090.t011e-71(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.44e-65LBD family protein