PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0023s0004.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 222aa    MW: 23820.7 Da    PI: 6.9251
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0023s0004.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.52.6e-4414112199
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear++dPvyG+vg i+ lq+q+++l
  Kaladp0023s0004.1.p  14 PCAACKFLRRKCLPGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVKDPVYGCVGAISFLQRQVQHL 103
                          7***************************************************************************************** PP

               DUF260  91 kaelallke 99 
                          ++el+++++
  Kaladp0023s0004.1.p 104 QKELDAANA 112
                          ****99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.58813114IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-4314111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MPMATSSSSA YSSPCAACKF LRRKCLPGCI FAPYFPPEEP QKFANVHKIF GASNVTKLLN  60
ELLPHQREDA VNSLAYEAEA RVKDPVYGCV GAISFLQRQV QHLQKELDAA NADLIRMACS  120
DHHCYHHIPA ALPVSAASSG MQIQQQGALN SGFQSNMRQV ERSEYGRRSA FGGGGAGMMD  180
HGSSLYQNPT STGGFNFAFA LPWSDSTGQV NDGSLGDQGD I*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007036350.13e-83Lateral organ boundaries domain family protein
SwissprotQ9FML44e-71LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A061FUD53e-83A0A061FUD5_THECC; Lateral organ boundaries domain family protein
STRINGGLYMA04G36080.12e-81(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.45e-65LBD family protein