PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0016s0028.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 129aa    MW: 14454.6 Da    PI: 8.4802
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0016s0028.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.73.1e-41101091100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +Ca Ck+l+rkC+++C++apyfp ++p kf nvhk+FG snv+kll++lp+++r+da++s++yeA ar+rdPv+G+v+ i +lq+q++ l
  Kaladp0016s0028.1.p  10 PCACCKFLKRKCPPECIFAPYFPPQDPYKFINVHKIFGSSNVSKLLNELPPHQRSDAVKSMAYEAAARVRDPVHGCVAEICSLQRQVQLL 99 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          ++el++++++
  Kaladp0016s0028.1.p 100 QKELEAANAR 109
                          ****998865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.2099110IPR004883Lateral organ boundaries, LOB
PfamPF031958.2E-4110107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MASSGFFDSP CACCKFLKRK CPPECIFAPY FPPQDPYKFI NVHKIFGSSN VSKLLNELPP  60
HQRSDAVKSM AYEAAARVRD PVHGCVAEIC SLQRQVQLLQ KELEAANARL RNYETLNNYP  120
AYSLPWNG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006600621.16e-56PREDICTED: LOB domain-containing protein 25-like
RefseqXP_006600622.16e-56PREDICTED: LOB domain-containing protein 25-like
SwissprotQ9FML42e-55LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A0B2Q9Z86e-56A0A0B2Q9Z8_GLYSO; Protein LATERAL ORGAN BOUNDARIES
TrEMBLK7MKN06e-56K7MKN0_SOYBN; Uncharacterized protein
STRINGGLYMA17G09380.22e-55(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.41e-56LBD family protein