PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0011s1252.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family FAR1
Protein Properties Length: 613aa    MW: 71741.8 Da    PI: 8.4322
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0011s1252.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR168.22.1e-2154140290
                 FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                           Yn+YA+++G s+r++k+++++ + + t+r+fvCskeg+++ +k++  k++ +r+ trtgC+a ++ + +++g++ v++ e eH+H+++
  Kaladp0011s1252.1.p  54 LYNDYARRIGLSIRRAKQRYRRGESSLTMRQFVCSKEGTKNAKKES--KRSYSRNITRTGCQAFIQFSIDQEGRYTVQRHEMEHTHDFS 140
                          6****************************************99988..9999**********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.0E-1854140IPR004330FAR1 DNA binding domain
PfamPF105514.6E-30261354IPR018289MULE transposase domain
PROSITE profilePS509668.778516554IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 613 aa     Download sequence    Send to blast
MVDMSTFKKS DMLESEVPGN TDESIRNQRA KFFEAKNSEL IGLVVESEED AYALYNDYAR  60
RIGLSIRRAK QRYRRGESSL TMRQFVCSKE GTKNAKKESK RSYSRNITRT GCQAFIQFSI  120
DQEGRYTVQR HEMEHTHDFS DIRQRHLMRS QRSISDEQIE LLKSFRKCGI KLSDAIRFLK  180
CQFGGSPNIG FINIDAYNAL ANPECKTFNG SYAKNLIEIF KERQENEDDF YNFDLDEDGR  240
LCGYFWRDGI MKKDYDLFGL VVHDTTYRTN KYDMVCGPFV GMNQHTNNVM FGCGFIINER  300
VESFVWLFQS FLKSMGDKAP ITIMTDESAA MAAGIKKVFP TSKHRLCIWH IIKNSKERII  360
SLRKNDGFIH LFNHLLKGCD SEAEFNFYWQ RMITVYHCAD NPWIIKFYKT KEKWCGAFCK  420
EFFSGGILSS QRSETTNKSV SRRLNKLSCL CEFYYTFCDV VSEWRSNEMK FNYSNSNGIP  480
EMVVSNSNLL RHARDVYTRN IYKIFEDRFL DGIDMFRHYV RFSAETLLVE CTCKCFTQDC  540
LLCMHSLRVL NIHCVQRIPD AYILKRWRKD IRKDCQESDQ SLCTAKIHYE IANSYENRNT  600
FDTGTILVNK SV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.15e-88FAR1-related sequence 5