PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0011s0974.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 181aa    MW: 19830.5 Da    PI: 7.3011
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0011s0974.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601421.9e-4471061100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +Ca+Ck+lrr+CakdC++apyfp+++p+kfa vhk+FGasnv+k+l++lp ++r+da+sslvyeA ar+rdPvyG+vg i+ lq+q++ql
  Kaladp0011s0974.1.p   7 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFATVHKVFGASNVSKMLQELPLHQRSDAVSSLVYEASARMRDPVYGCVGAISYLQSQVSQL 96 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          + +la++++e
  Kaladp0011s0974.1.p  97 QMQLAVAQAE 106
                          ******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.9556107IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-437104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MAGGNSPCAS CKLLRRRCAK DCIFAPYFPS DDPHKFATVH KVFGASNVSK MLQELPLHQR  60
SDAVSSLVYE ASARMRDPVY GCVGAISYLQ SQVSQLQMQL AVAQAEILCI QMQQEPAAAS  120
SLATIQPTLS VDDKSFLFNN SQLIGNNNIN QLSQLFNYSA SSTNNVINDY SLRDRESLWT  180
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015874639.15e-86PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW37e-75LBD12_ARATH; LOB domain-containing protein 12
TrEMBLM0U1B07e-86M0U1B0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P18030_0012e-85(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-62LBD family protein