PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0010s0165.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 191aa    MW: 20580.2 Da    PI: 6.1
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0010s0165.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.47.6e-41151141100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+l+r+C++ C++apyf +++p kfa vhk+FGasnv+k+l+++pee+r++++++lvyeAear++dPvyG++g i +lq++l++l
  Kaladp0010s0165.1.p  15 SCAACKLLKRRCSPTCIFAPYFRSDDPTKFAKVHKVFGASNVSKILSEVPEEQRQETVNTLVYEAEARLEDPVYGCIGAIAALQRKLAEL 104
                          6***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          + +la ++++
  Kaladp0010s0165.1.p 105 QRDLAIARAR 114
                          ****999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.59514115IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4015112IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MRNTSLHHEP RAASSCAACK LLKRRCSPTC IFAPYFRSDD PTKFAKVHKV FGASNVSKIL  60
SEVPEEQRQE TVNTLVYEAE ARLEDPVYGC IGAIAALQRK LAELQRDLAI ARARLAGYGT  120
CLSNASSSSG ATGNWVDQQH LIDSMSCFTQ MNDGLGGDGY NSNACVDIDQ LIASAYGFEV  180
GLSTASFPFE *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010067552.16e-66PREDICTED: LOB domain-containing protein 21 isoform X1
RefseqXP_010067553.14e-66PREDICTED: LOB domain-containing protein 21 isoform X2
SwissprotQ9SRL84e-63LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A059BI254e-66A0A059BI25_EUCGR; Uncharacterized protein
STRINGVIT_13s0067g01450.t011e-64(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.15e-64LOB domain-containing protein 21