PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0007s0085.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family FAR1
Protein Properties Length: 121aa    MW: 14054.9 Da    PI: 9.657
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0007s0085.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR172.11.2e-2229114289
                 FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                           Yn+YA+++GFs+r++k+++++ + + t+r+fvCskeg+++ +k++  k++ +r+  rtgC+a ++ + +++g++  ++ e eH+H++
  Kaladp0007s0085.1.p  29 LYNDYARRIGFSIRRAKQRYRRGESSLTMRQFVCSKEGTKNAKKES--KRSYSRNIIRTGCQAFIQFSIDQEGRYTAQRHEMEHTHDF 114
                          6****************************************99988..9999**********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.2E-1929114IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MADMSTFKKP DMLESEVLVV EPEEAAYALY NDYARRIGFS IRRAKQRYRR GESSLTMRQF  60
VCSKEGTKNA KKESKRSYSR NIIRTGCQAF IQFSIDQEGR YTAQRHEMEH THDFSLDKGI  120
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.22e-11FAR1 family protein