PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0007s0082.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family FAR1
Protein Properties Length: 569aa    MW: 66794.4 Da    PI: 9.0606
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0007s0082.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR172.97.1e-2348134290
                 FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                           Yn+YA+++GFs+r++k+++++ + + t+r+fvCskeg+++ +k++  k++ +r+ trtgC+a ++ + +++g++ v++ e eH+H+++
  Kaladp0007s0082.1.p  48 LYNDYARRIGFSIRRAKQRYRRGESSLTMRQFVCSKEGTKNAKKES--KRSYSRNITRTGCQAFIQFSINQEGRYTVQRHEMEHTHDFS 134
                          6****************************************99988..9999**********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031017.6E-2048134IPR004330FAR1 DNA binding domain
PfamPF105513.1E-30257350IPR018289MULE transposase domain
PROSITE profilePS509669.371484522IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
MSAYSNSSVK STRYSPELTI NQRAKFFEAK NSELIGLVVK SEEAAYALYN DYARRIGFSI  60
RRAKQRYRRG ESSLTMRQFV CSKEGTKNAK KESKRSYSRN ITRTGCQAFI QFSINQEGRY  120
TVQRHEMEHT HDFSDIRKRH LMRSQRSISD EQIELLKSFR KCGIKLSDAI RFLKCQYGGS  180
PNIGFINIDA YNALANPDCK TFNGSDAKTL IEIFKERREN EDDFFYNFDL DEDGRLCGFF  240
WRDGIMKKDY DLFGDLVVHD TTYRTNKYDM ICGPFVGMNQ HTNNVMFGCG FIINERVESF  300
VWLFQSFLKS MGDKAPITIM TDESAAMAAG IKKVFPTSKH RLCIWHIIKN SKERIISLRK  360
KDGFIHLFNH LLKGCDSEAE FNFYWQRRLN KLSGLCEFYC TFCDVVSEWR SNEMKFNYSN  420
SNGIPKMVVS NSNLLRHARD VYTRNIYKIF EDRFLDGISC TQMIVPSEPN VFCYNVWREG  480
IDMFRHYVRF AAETFLVECT CKYFTQDGLL CMHSLRVLNI HCVQRISDAY ILKRWRKDIQ  540
KDCQESDQNI LKLFSRCIRY LLDYRNTI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.14e-82FAR1-related sequence 5