PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0003s0053.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family SRS
Protein Properties Length: 358aa    MW: 39371.3 Da    PI: 7.8426
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0003s0053.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702194.34.2e-601362893154
               DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstkls 92 
                           g+++CqdCGnqakkdC h RCRtCCksrgf+C+th+kstWvpa+krrerqqqla+++++++++ +  +++ +    ++ +  l++t++s
  Kaladp0003s0053.1.p 136 GGGMNCQDCGNQAKKDCPHLRCRTCCKSRGFQCQTHIKSTWVPASKRRERQQQLASLQQQQSQQLQLRSHDITL---KRPRGELTTTNTS 222
                          5789****************************************************988876654332222222...2233333333322 PP

               DUF702  93 saeskkeletsslPeevsseavfrcvrvssvd..........dgeeelaYqtavsigGhvfkGiLydqGlee 154
                                    + +P+ev+s+avfrcvrvss+d            ++++aYq+avsigGhvfkGiLydqG+e+
  Kaladp0003s0053.1.p 223 G-----LDLSNMFPSEVNSQAVFRCVRVSSMDpehnaneehgHHDDQFAYQAAVSIGGHVFKGILYDQGPES 289
                          2.....223355*******************8544443322123689***********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.8E-60138288IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.5E-26140182IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016249.6E-21230287IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MAGFFSSLSG GVRDEQEEEH DQQQPPPAAA NSLFLYRSEE IYKQQQGLEI WQQQQFYRQQ  60
QLQQQQQQQQ QQYLPRDQHH HHHHIISYAA AAAPPPSLMA PTSSRRLSFN VSSDASSSRS  120
GGGGFTVMRG SGSGSGGGMN CQDCGNQAKK DCPHLRCRTC CKSRGFQCQT HIKSTWVPAS  180
KRRERQQQLA SLQQQQSQQL QLRSHDITLK RPRGELTTTN TSGLDLSNMF PSEVNSQAVF  240
RCVRVSSMDP EHNANEEHGH HDDQFAYQAA VSIGGHVFKG ILYDQGPESR YGESSSGGSG  300
AYQQPQQQLN LITSGAAATA ATSSPVVTTQ LLDASLNYPT PINAFMAGTQ FFPPSRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022856966.14e-93protein SHI RELATED SEQUENCE 1-like
TrEMBLA0A061DFV62e-86A0A061DFV6_THECC; Lateral root primordium protein-related, putative
STRINGEOX909423e-87(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.14e-48Lateral root primordium (LRP) protein-related