PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0001s0227.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family LBD
Protein Properties Length: 216aa    MW: 23416.7 Da    PI: 6.339
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0001s0227.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601352.8e-42361351100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca++C+lapyfp ++p+kf ++h++FGasn++kll++lpe +r da+ss+vyeA ar+rdPvyG++g i +lq+++++l
  Kaladp0001s0227.1.p  36 PCAACKILRRRCADKCILAPYFPPTEPQKFTIAHRVFGASNIIKLLQDLPEAQRADAVSSMVYEASARIRDPVYGCAGAICHLQNHVREL 125
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +a+la+ k+e
  Kaladp0001s0227.1.p 126 QAQLAKSKAE 135
                          *****99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.17235136IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-4236133IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MEHSERSWRS SATPSPISSP SSSPPPPQKT TVIMSPCAAC KILRRRCADK CILAPYFPPT  60
EPQKFTIAHR VFGASNIIKL LQDLPEAQRA DAVSSMVYEA SARIRDPVYG CAGAICHLQN  120
HVRELQAQLA KSKAEIVNLQ AHQAQLVALI CVEVSSAQPN NNTTKTASDQ LFDCGGFFGS  180
PLAEDFYSGL GFEVESDGMG SMGWEMPLWP DMMIS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003597159.12e-78lateral organ boundaries (LOB) domain protein
SwissprotQ9SK089e-68LBD11_ARATH; LOB domain-containing protein 11
TrEMBLG7IKN32e-78G7IKN3_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA13G40370.23e-77(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.17e-69LOB domain-containing protein 11