PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl01575_0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family ZF-HD
Protein Properties Length: 242aa    MW: 25328.3 Da    PI: 7.277
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl01575_0010genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer44.53.5e-141967957
    ZF-HD_dimer  9 ClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57
                   Cl Nh  + G+ + DGC+ f+p++++  ++    C ACgCHR +H ++ 
  kfl01575_0010 19 CLNNHDLEAGAPVHDGCQAFVPKRHAGLEPPEDVCDACGCHRAYHQKTG 67
                   ***********************999899****************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5152314.2211666IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-61975IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.7E-121966IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MYAGGGWGGG LLAGHDGPCL NNHDLEAGAP VHDGCQAFVP KRHAGLEPPE DVCDACGCHR  60
AYHQKTGSAQ AQQPPPIGGA KKGLFERSSG FRPPPLTLAR AKGSTAMDNS EDDDPMAHLL  120
PHLAARRAQK RSLEEEGPAL DVGGEEARAP RRSGGVAIGG GEHICGRGEL ADVRAVEESM  180
FKAAVEESTR ASKAEAAHGK SEPQRVSPKT DPCSARYVFS PGPPASVSKK TSSRTWQFGP  240
VL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A1Y1IRJ61e-148A0A1Y1IRJ6_KLENI; Uncharacterized protein (Fragment)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60480.14e-12homeobox protein 26