PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00762_0030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family Dof
Protein Properties Length: 689aa    MW: 71055.1 Da    PI: 5.5897
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00762_0030genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.19.3e-39219279262
         zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                    ++k  +cprCds +tkfCyynny+++qPr+fCk+C+ryWt+GG+lrnvPvG+grrknk++s
  kfl00762_0030 219 PDKLEPCPRCDSYDTKFCYYNNYNIKQPRHFCKNCQRYWTAGGTLRNVPVGAGRRKNKHKS 279
                    688899****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-27216276IPR003851Zinc finger, Dof-type
PfamPF027015.3E-32221277IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.472223277IPR003851Zinc finger, Dof-type
PROSITE patternPS013610225261IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    Send to blast
MTSGLGRNPR ENGSPGKEQE QGSEHVSHAA AVATISMDPT AAEATDDGTG EDQRHQTGAV  60
DGPSSSSDNN RIVAEPQQSG QKGSIHAADR VRGGDAGVST LKDQEGDNSR NASGELGSSS  120
GSNSLDDGNC SNTAEGGKEQ QDGSSKQAEK QPPLQGQKLQ QAPGPSPKSL GCGSENRQKG  180
GKGGGNTKGG EEEEKEVQGK EEQGAGDQEE GGRPVLKKPD KLEPCPRCDS YDTKFCYYNN  240
YNIKQPRHFC KNCQRYWTAG GTLRNVPVGA GRRKNKHKSI QRLGPGSGSD SELVIPSSSG  300
GEDYLVRSGS LRSSNPSLNA TTFKPPASQG FQGRFVTSSN PPLYDSGTND KSGVTHKRDG  360
TSADEMQSGD QFRGPHYGGA AEAGPEADPR RAKRVKRNPP PETGVPVGRF GRGFRENSEC  420
MSSQADNRDG GAFVADAMMS PESAKNAQWP ARAGEAFGGP VTGWNQGAAV PATPTGGAWA  480
PGNTAPWGGM WNQPWPYQMP MGQRGTEAGG DDEPGGAQVM ATPGANYGAS PQGANWGMVD  540
NSSFGGGANW GASPVNAANA AAAWANANVW AGLAAAGNAW GPPWAAWSVF GAGPAAAAAG  600
MAPSPQPAPG GGMGKHRQEG GGEGETRADG VWVPKIVRTE PVRGSAPLQW QQQLGGGGDA  660
GYLGLMKNGE MADSPGGQED GVPTPLNLL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A1Y1IRN60.0A0A1Y1IRN6_KLENI; Dof zinc finger protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-33cycling DOF factor 2