PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00480_0040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 1329aa    MW: 146037 Da    PI: 11.1199
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00480_0040genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.95.4e-14272316145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg+WT +Ede+l+++v+++ g++W ++a+++g+gRt+  c  ++q
    kfl00480_0040 272 RGPWTLDEDEQLKELVTKHEGHDWVSVAAELGTGRTAAACLMHYQ 316
                      89*****************************************99 PP

2Myb_DNA-binding41.53e-13333379148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++ WT+eE ++l  av+ +G+ +W  +a+ +g +Rt+ qc++rw ++l
    kfl00480_0040 333 KQLWTEEENLRLRYAVAAFGTTSWVHVAEVVG-TRTDPQCRERWVNVL 379
                      577*****************************.***********9975 PP

3Myb_DNA-binding33.97.3e-11387432344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHT....TTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmg....kgRtlkqcksrw 44 
                      +WT+eEd +l  +v+qlG g W+  a +++    ++Rt+  ++ ++
    kfl00480_0040 387 PWTAEEDARLEALVRQLGAGKWAQLADEFNagrpLKRTDDRLRKHY 432
                      8********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-5146162IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.3E-5237271IPR009057Homeodomain-like
SuperFamilySSF466891.63E-12250320IPR009057Homeodomain-like
PROSITE profilePS5129415.832267323IPR017930Myb domain
SMARTSM007171.7E-9271321IPR001005SANT/Myb domain
PfamPF002499.5E-11272316IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-12272320IPR009057Homeodomain-like
CDDcd001672.25E-7274317No hitNo description
PROSITE profilePS5129419.406328383IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-14331378IPR009057Homeodomain-like
SMARTSM007175.7E-13332381IPR001005SANT/Myb domain
CDDcd001672.06E-10336379No hitNo description
PfamPF139212.6E-12336396No hitNo description
SuperFamilySSF466891.57E-17359437IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-12379440IPR009057Homeodomain-like
SMARTSM007171.7E-8384438IPR001005SANT/Myb domain
PROSITE profilePS5129411.52386440IPR017930Myb domain
CDDcd001671.00E-6387436No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1329 aa     Download sequence    Send to blast
MEQTTADPPP EGGASHTEAP GILPFASADN PELIMEALQR NRACQKSMTA VLEAIQERIR  60
ANAMLQKKVR AVVKASKEVG AKPKEADMGV RTAGLDWPGR KKPKSRRTGC SRIFVALDGT  120
GPEENPDIAR TQPVRAVLAA CAREQRWSEA DKERLRGAVR LQVQEKWVTE LMAALQSWQV  180
GAIRPQVQGK WETDLTAALQ REGREQGTGV SLSALHSGMA QMRQRPVTDD DITAALPTLD  240
WENVMTKAKL VGKTAEDCQA CWTADCAPGI NRGPWTLDED EQLKELVTKH EGHDWVSVAA  300
ELGTGRTAAA CLMHYQRDLR EERPEPRLGP VRKQLWTEEE NLRLRYAVAA FGTTSWVHVA  360
EVVGTRTDPQ CRERWVNVLD PSVDQSPWTA EEDARLEALV RQLGAGKWAQ LADEFNAGRP  420
LKRTDDRLRK HYEALVTNKM IEPITTVPSP AAPPELQLTV ADSNASRLIR RREAAQAREA  480
KRKTAIVPRE KITEISHSKR GRKPKQAKET AGIRKTGKSR LPPPLALSKA VPPPLEPGLS  540
NVLRLVHAKK VQPTHVGRTG KPAAVVDGKS VHFMQRHVQP VIPVARPVTA SQPPPVIAQA  600
NGHLGVGQIR GDQRTGARAK GAPRGPVAVR VSKPKLTLEE RLAQRREKDR RRRAADRAER  660
EAAEERNGTA AERVAARLGK EQERQEKRQR KEEERKRKEE ARKRAREETR RRLQQERDEA  720
QKKREAMKET LRREREEARA KRMREKEAEK EAKQRKKAEE DAATGAEGTG RKAAAHGGRE  780
ETQVGRAKVQ RPVSKKVRKD EGVGTATGKG AQKKGGRGAR VGVRVGPAKK GAVQADGKAQ  840
RGATRGKKDA KKKAAVGRGA RKGGDQRAEK RADGEAAEQA RGSRAQGASP GGRSSQRLRA  900
VGRPVTERSG NSGADDLERN ATEGKRKKAG RKRAAEPEGS QGRPAKRGKV EEGTGTEEGT  960
EVVRVTRSRQ ELVTSTRKRR REEGDEQQRG GTREGAEKGP GERRGKKGRV EGAKGNNETI  1020
VQAGEKKDGR KVKGKLDKNK EPGRMTRSTH MQDAARVTRS GERGTRRSER ERGEGKKRDG  1080
GVGEVGPGKR DENGKKSVSP TRSLRRVSRD GGSAGEETGV DVREEKESKP RQRTSRLGSA  1140
DIDEVSGTEG SECSEESEID GRVCAPARSP EKRTRAKKTA ADAEPGNDVT SPDGKLPGGR  1200
ETRGRKGRAE AAVWGVPKVR EREGELEAAG KRVPEQERSL RAGDKREGGG VPSGKKKRKR  1260
PPTQEGRAAT LPSKDPRTGT RGAEKVRGKQ APPREAKSDQ LVQDRSSTRK TRLTDTEPRR  1320
SLRNSKRNT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C5e-172754341153MYB PROTO-ONCOGENE PROTEIN
1h88_C5e-172754341153MYB PROTO-ONCOGENE PROTEIN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1643650QRREKDRR
2976980RKRRR
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP73551617
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.13e-36myb domain protein 4r1