PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00369_0070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family G2-like
Protein Properties Length: 556aa    MW: 59697.3 Da    PI: 6.4757
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00369_0070genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1049.1e-33277332156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  kfl00369_0070 277 KQRRCWSPELHRRFVNALNQLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 332
                    79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.371274334IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-29275335IPR009057Homeodomain-like
SuperFamilySSF466896.81E-18275335IPR009057Homeodomain-like
TIGRFAMsTIGR015579.7E-27277332IPR006447Myb domain, plants
PfamPF002492.9E-7279330IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MSDDADRQEL QEYLRGLEEE RRKVEAFKRE LPLCMQLLTD AIQSTQAQLK ADDEPMDSDD  60
VSEPERPRDR SHHSHRPIPT IPPHPAHLPF PPPFRGSPAW LSEAISVRAA QQTGVEQRAL  120
EQRMEGLGPP RGERAPGRPL RDGGEERAGP QLFRTPGAFL PFSREQHSPH VARPSSPRAI  180
TYPLAVHLTP GGLAAGSGQD HDGSPASVLE ERRSQTAPAG PSDTEGGHSG EGTAMATDGT  240
GRNVKITSLF PLFIYLPPGS FAWQHGGDVA TGAMSRKQRR CWSPELHRRF VNALNQLGGS  300
QVATPKQIRE LMKVDGLTND EVKSHLQKYR LHTRRPSPIP TSGASPGPGQ VVVLGSIWVP  360
PEYNAAASSA AALYDAATAA ASAPSQAGHA PSLDEARGIP PGAFHSLDEA RGIPPGAFPF  420
FQVASGLLAG RHRPSASSTE MDLGVSGSGE EGGQNQGGFL KAEVKEGSAF GAFRAFKPLG  480
GNQAERNVED TEPVHRERRA AAAPDDASES MREEVPKVKP PGRDLDEDES SEGEVVHRGF  540
RNFLPPRPEA SAQKPG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-14277330154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-14277330154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-14277330154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-14277330154Protein PHOSPHATE STARVATION RESPONSE 1
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A1Y1IFY70.0A0A1Y1IFY7_KLENI; Transcription factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP43031624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.15e-44G2-like family protein