PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00255_0040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family LBD
Protein Properties Length: 367aa    MW: 39460.8 Da    PI: 9.6728
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00255_0040genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260119.91.4e-37104202199
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrrkC+++C +ap+fp+++++kf+ +h+ +Ga+n++kll+ lp++ r da++sl+yeA+ar+ dPvyG+vg +  lq+q e+lk+ela+
  kfl00255_0040 104 PCAACKFLRRKCTDECLFAPHFPQSEKEKFQSLHRCYGAANIIKLLSGLPKDLRGDALQSLAYEAQARIVDPVYGCVGAVAILQRQNEKLKTELAQ 199
                    7*********************************************************************************************98 PP

         DUF260  97 lke 99 
                     ++
  kfl00255_0040 200 ERA 202
                    775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.367103204IPR004883Lateral organ boundaries, LOB
PfamPF031955.4E-37104200IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MSGRLKIFIG NGNAAPAAAL QTTARSGAFF LERQPLDKLR CKANQPPKRH GMQKRSSIGL  60
FPAFGLSCDN LDTLSGGRMT SSDKDGGSQG PQPTTSGQQE ARSPCAACKF LRRKCTDECL  120
FAPHFPQSEK EKFQSLHRCY GAANIIKLLS GLPKDLRGDA LQSLAYEAQA RIVDPVYGCV  180
GAVAILQRQN EKLKTELAQE RASVAKLTQM RSQSPSSSQQ TKRSRTPPLV CQSSLNSLAA  240
PTPVHPMALV TSRFAPQIPN STLEFLLAEL TRTHSPTPEV GSPTSAQTTN SPSSYTFDSS  300
STLETNAVLD FDPFDIPASA KRARLAPTGG AAPLPAGLAK LESDRFDMRF GSPIGPLEMS  360
VFRAEYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-37931973104LOB family transfactor Ramosa2.1
5ly0_B4e-37931973104LOB family transfactor Ramosa2.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A1Y1IAR00.0A0A1Y1IAR0_KLENI; Lateral organ boundaries (LOB) domain-containing protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.12e-37LOB domain-containing protein 25