PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00209_0160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family LBD
Protein Properties Length: 168aa    MW: 17662.2 Da    PI: 9.0306
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00209_0160genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.91e-44111101100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    aCaaCk+lrrkC+++C +apyfp +qp+kfanvhk+FG++n++kll++lp ++reda++sl+yeA+ar++dPvyG+vg i+ lqqq++ql+a+la 
  kfl00209_0160  11 ACAACKFLRRKCTAQCLFAPYFPPDQPQKFANVHKIFGVANITKLLSELPLHQREDAVNSLAYEADARVKDPVYGCVGAISVLQQQVAQLSADLAI 106
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +++e
  kfl00209_0160 107 ANAE 110
                    9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.34110111IPR004883Lateral organ boundaries, LOB
PfamPF031956.7E-4311108IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MRMAGNSAGS ACAACKFLRR KCTAQCLFAP YFPPDQPQKF ANVHKIFGVA NITKLLSELP  60
LHQREDAVNS LAYEADARVK DPVYGCVGAI SVLQQQVAQL SADLAIANAE LARYQQRGPA  120
QGGLQQQAGP SDPLAFATLA GTMAALGGMQ GQGGSVGPLQ RPPHGRQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-5581148114LOB family transfactor Ramosa2.1
5ly0_B2e-5581148114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024361359.13e-62protein LATERAL ORGAN BOUNDARIES-like
SwissprotQ9FML45e-55LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A1Y1I1S11e-118A0A1Y1I1S1_KLENI; Lateral organ boundaries (LOB) domain-containing protein
STRINGPP1S71_7V6.11e-61(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.12e-50LOB domain-containing protein 25
Publications ? help Back to Top
  1. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  2. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]