PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00202_0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family HD-ZIP
Protein Properties Length: 411aa    MW: 44897.5 Da    PI: 4.9506
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00202_0020genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.62.8e-15120172456
                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    +++++k q++eLe+l++   +   + r+ +A+ lg terqV +WFqNrRa+++
  kfl00202_0020 120 KRKLSKVQVRELEKLYQGGYTGAPAGRAAIAADLGTTERQVAIWFQNRRARQR 172
                    45899**********************************************99 PP

2HD-ZIP_I/II77.72e-25118206189
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                    ++kr+lsk qv+ LE+ ++   +  p  ++++a +Lg + rqva+WFqnrRAR ++kq+ ++y+ Lk+ +  +  en+r+++e +eLr 
  kfl00202_0020 118 QRKRKLSKVQVRELEKLYQGGYTGAPAGRAAIAADLGTTERQVAIWFQNRRARQRSKQTTQEYDLLKKDFRLILLENKRMRQELTELRL 206
                    59*************************************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007114.285114174IPR001356Homeobox domain
SuperFamilySSF466897.27E-13115175IPR009057Homeodomain-like
SMARTSM003891.0E-12117178IPR001356Homeobox domain
CDDcd000864.15E-7118175No hitNo description
Gene3DG3DSA:1.10.10.601.3E-14118180IPR009057Homeodomain-like
PfamPF000461.2E-12120172IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MGFIICCPKE EVLASQAAQD MMQLVSAPLP VPPQSKLQLV VCLTPPLTPL VAEVFASQAA  60
QEIMQLVVSH HDSEELEQSS TQERTAPAVS GARSVKGGTS KASEEELGES QGDGGGDQRK  120
RKLSKVQVRE LEKLYQGGYT GAPAGRAAIA ADLGTTERQV AIWFQNRRAR QRSKQTTQEY  180
DLLKKDFRLI LLENKRMRQE LTELRLLVER SDATPDHAFL NFSASEKESA AARFDAAEPA  240
GQRALMPALH SPMVPIRAPG GVLEAPVENP RESLPRYAEG PPSHKRLRVD PPMATEGFAS  300
ESVHPVFGDV DFTDELWDSV ISSLEQSFGS EVIQDLFRNG DAFAELGLPK PPKYGYSLSL  360
QETRPGECHV SHVDHVARGR TDAGDLSLVQ SALAFQSDDY VGINSPCWAD L
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A1Y1I7N10.0A0A1Y1I7N1_KLENI; Homeobox-leucine zipper protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18550.17e-14homeobox protein 21