PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00147_0060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family LBD
Protein Properties Length: 156aa    MW: 16935.5 Da    PI: 7.5035
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00147_0060genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601461e-4591081100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrrkC++dC +apyfp +qp+kfanvhk+FGasn++kll++lp ++reda++sl+yeA+ar++dPvyG+vg i+ lqqq+++l+aela 
  kfl00147_0060   9 PCAACKFLRRKCTPDCLFAPYFPPDQPQKFANVHKIFGASNITKLLHDLPLSQREDAVNSLAYEADARVKDPVYGCVGAISVLQQQVAHLQAELAI 104
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +++e
  kfl00147_0060 105 AHAE 108
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0318109IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-449106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MAGPSQMSPC AACKFLRRKC TPDCLFAPYF PPDQPQKFAN VHKIFGASNI TKLLHDLPLS  60
QREDAVNSLA YEADARVKDP VYGCVGAISV LQQQVAHLQA ELAIAHAELT RIHTTTVPPL  120
QDDHENPAVL SVAMSSRPLV SQALASYAGL KPDSMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-5741116113LOB family transfactor Ramosa2.1
5ly0_B1e-5741116113LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024356367.14e-61protein LATERAL ORGAN BOUNDARIES-like isoform X1
SwissprotQ8L8Q38e-55LBD25_ARATH; LOB domain-containing protein 25
SwissprotQ8LBW32e-54LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A1Y1I1U41e-111A0A1Y1I1U4_KLENI; Lateral organ boundaries (LOB) domain-containing protein
STRINGPP1S170_93V6.11e-60(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.14e-57LOB domain-containing protein 25
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]