PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00130_0250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family HD-ZIP
Protein Properties Length: 381aa    MW: 42108.1 Da    PI: 6.6296
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00130_0250genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.21.4e-18244298256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    rk+ +++keq e Le++F++n++++ +++  LA+kl+L  rqV vWFqNrRa+ k
  kfl00130_0250 244 RKKLKLSKEQAELLEKAFRENNTLNPAAKSTLATKLNLRARQVEVWFQNRRARTK 298
                    678899***********************************************98 PP

2HD-ZIP_I/II116.12.1e-37244332189
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                    +kk++lskeq++lLE+ F+e+++L+p  K++la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr+
  kfl00130_0250 244 RKKLKLSKEQAELLEKAFRENNTLNPAAKSTLATKLNLRARQVEVWFQNRRARTKLKQTEVDCEVLKRCCETLTEENRRLQKELSELRA 332
                    69*************************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-17226298IPR009057Homeodomain-like
SuperFamilySSF466894.28E-17239301IPR009057Homeodomain-like
PROSITE profilePS5007116.811240300IPR001356Homeobox domain
SMARTSM003891.5E-14242304IPR001356Homeobox domain
PfamPF000466.5E-16244298IPR001356Homeobox domain
CDDcd000861.24E-14244301No hitNo description
PROSITE patternPS000270275298IPR017970Homeobox, conserved site
CDDcd146860.00621293332No hitNo description
PfamPF021831.0E-10300332IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.1E-18300346IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MTICPPKYRF SVDMSSQEKA KYMLAPGGTD FSSFHSTMQE TNSDNEYNTA SETGGSKGLH  60
HPQPQLPVNG VTLHFPNQGN STRGFHLPPI IAPPMTFDTT WQLSPATAQM AYDMVFNRQP  120
SPSANAMRPQ VMRMQDGLGQ LTSLTTNGDE GAFQQVARST DLLVQPPHLM DSLNRNPVSA  180
PLTVNLTSGS DVNAPIDVNM QPPQRDEGDS AGQSEEFDDD DVKPSVSGRK RDAQGGGEES  240
VTGRKKLKLS KEQAELLEKA FRENNTLNPA AKSTLATKLN LRARQVEVWF QNRRARTKLK  300
QTEVDCEVLK RCCETLTEEN RRLQKELSEL RASQGQSGLQ EFLGHMPAAT LSMCPSCERL  360
TALDPVRGSV IINRGNNQYE R
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1292300RRARTKLKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002968858.28e-53homeobox-leucine zipper protein HAT4
TrEMBLA0A1Y1HYZ40.0A0A1Y1HYZ4_KLENI; Homeodomain leucin zipper protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-52HD-ZIP family protein