PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00115_0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family LBD
Protein Properties Length: 285aa    MW: 30678.6 Da    PI: 5.3261
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00115_0010genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260115.63.1e-3642140199
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCkvlrrkC+++C lap+fp +++ kf ++hk +Ga+n++k+l+++p+  r da+s+l+yeA+ar+ dPvyG+vg+i  lq q+++l+ael++
  kfl00115_0010  42 PCAACKVLRRKCTEECLLAPHFPLREKDKFLVLHKCYGAANLMKILADIPKYLRGDAISCLAYEAQARTLDPVYGCVGIIAVLQDQIASLQAELET 137
                    7*********************************************************************************************99 PP

         DUF260  97 lke 99 
                     ++
  kfl00115_0010 138 ERS 140
                    876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.39541142IPR004883Lateral organ boundaries, LOB
PfamPF031955.6E-3642138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MDRLLPAASD GTDTVGEESS LHPQPCSLPN ASSPRGGYCR SPCAACKVLR RKCTEECLLA  60
PHFPLREKDK FLVLHKCYGA ANLMKILADI PKYLRGDAIS CLAYEAQART LDPVYGCVGI  120
IAVLQDQIAS LQAELETERS NLAGMRRVRS LSTLSQDSKQ AIQLPALLEL PESEKRDSRQ  180
VKEEALQLSQ TWQPSTPSTQ AGVHNMQLCG VTAMPADLAP ASAPQYPVSV PGAQEIAQSS  240
QSTAALDFAV PHFAFGPDDD VGNNNDGAHP ATWGSYADPI ADFHH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-334114210111LOB family transfactor Ramosa2.1
5ly0_B3e-334114210111LOB family transfactor Ramosa2.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A1Y1HV720.0A0A1Y1HV72_KLENI; Lateral organ boundaries (LOB) domain-containing protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.11e-36LOB domain-containing protein 25