PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00081_0170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family HD-ZIP
Protein Properties Length: 380aa    MW: 41400.8 Da    PI: 5.386
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00081_0170genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.82.4e-1596147556
                    SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++ k+q++eLe++F++  +   e r  + kk+ +terqV +WFqNrRa+++
  kfl00081_0170  96 KKLPKDQVKELEAMFQSGYTGAPEGRSAIGKKMCITERQVAIWFQNRRARQR 147
                    567799********************************************99 PP

2HD-ZIP_I/II83.92.3e-2794185293
    HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                    kk++l k+qvk LE +F++  +  pe ++++ +++ ++ rqva+WFqnrRAR ++kql +d+e+Lk+ +  +  en+ ++ke +eLr++++e
  kfl00081_0170  94 KKKKLPKDQVKELEAMFQSGYTGAPEGRSAIGKKMCITERQVAIWFQNRRARQRSKQLGNDFEMLKKDFRMVFLENQVMRKELAELRARVAE 185
                    9**************************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007114.12389149IPR001356Homeobox domain
SMARTSM003891.1E-892153IPR001356Homeobox domain
SuperFamilySSF466894.28E-1293150IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-1494152IPR009057Homeodomain-like
CDDcd000862.30E-1194150No hitNo description
PfamPF000461.3E-1295147IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MAGVGPGSSG RGNGRPQNSG RQPGLTSIDD QDASIAELQE LYANLREHSR TYQGAELGGA  60
SPSAPVHSSR SGAGAARSDE NSVGESLEEG IEDKKKKLPK DQVKELEAMF QSGYTGAPEG  120
RSAIGKKMCI TERQVAIWFQ NRRARQRSKQ LGNDFEMLKK DFRMVFLENQ VMRKELAELR  180
ARVAETDPSG LLQAQPPLEM AAPAAPAYSD FRIPSPGKRT SLDRPHHPGG EGLRERQSLD  240
DVEYLPRLKR ARLYQSEGGP FPGGNFGHPN RSLEPEPGGL NRQPSSGLLD AVVAQANVSP  300
LPGSGGLDFL DEREARQDLD AALLGPGHEG RLELGLRGNN TGWAPQRQFF DVLGNAGERG  360
DELEDDQIEP PRRDRDPDGW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A1Y1HS680.0A0A1Y1HS68_KLENI; Homeobox protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17460.14e-13Homeobox-leucine zipper protein 4 (HB-4) / HD-ZIP protein